Latest Contest entries
lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted 02:06 CST Today (14 hours ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (2 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (2 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (5 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (5 days ago)
Parablennius rouxi_August 2025
 CanonRF100 1/200 f9 iso100
By Antonio Venturelli
posted (last week)

Underwater Photo Location: bones bay, doolin.

Underwater Photo Location: bones bay, doolin.

How Hot is this Dive Site? click a star to rate it
head north around doolin point, not too far from the cliffs of moher. lots of caves and gullys. 11c-18c temp.
Facts about bones bay, doolin.
Dive types
dayboatcavewallnightdriftdrysuit

Marine Life
smalldolphinskelp

Diving facilities
airnitroxrepairshireinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyphireinstruction

by John Flynn
GUINNESS !! Goes down well anywhere. taken off doolin in co clare at 24m. olympus 560uz.
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication