Latest Contest entries
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted Yesterday
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (3 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (3 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (6 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (6 days ago)
Parablennius rouxi_August 2025
 CanonRF100 1/200 f9 iso100
By Antonio Venturelli
posted (last week)

Underwater Photo Location: las Galletas, chuchos

Underwater Photo Location: las Galletas, chuchos

How Hot is this Dive Site? click a star to rate it
At 2 minutes by boat from the harbor a wonderful site with huge rays, a bank of bastards grunts, trumpet fish, glass eyes, tiger and normal eals, a site full of life.
Facts about las Galletas, chuchos
  • It is in Spain
  • las Galletas, chuchos is in the Atlantic (European coastal).
  • The typical depth is 0-20 Metres 0-60 Feet.
  • The typical visibility is 3-10 Metres 10-30 Feet.
Dive types
dayboat

Marine Life
bigsmallturtles

Diving facilities
airhireinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyphireinstruction

by Erna Lucas
Agatha, our friendly turtle - Tenerife, Canary Islands panasonic dmc-ft1 lumix

by Rune Edvin Haldorsen
Moray eel
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication