Latest Contest entries
Eyes of the Ocean Seeds of Life A blenny resting in a mussel shell while tiny eggs gently decorate its surface.
By Gozde Karayel
posted 13:08 CST Today (within the last hour)
Serpula vermicularis_August 2025 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted 08:17 CST Today (5 hours ago)
Lamprohaminoea ovalis_August 2025 CanonRF100 1/200 f16 iso100
By Antonio Venturelli
posted (4 days ago)
Hypselodoris krakatoa nudibranch_March 2025 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (6 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (6 days ago)
Passage in Ressel France
By Andy Kutsch
posted (last week)

Underwater Photo Location: Bodu Giri, Kuredu Island

Underwater Photo Location: Bodu Giri, Kuredu Island

How Hot is this Dive Site? click a star to rate it
perfect place for pros and begginers
Facts about Bodu Giri, Kuredu Island
  • It is in Maldives
  • Bodu Giri, Kuredu Island is in the Indian Ocean.
  • The typical depth is 0-30 Metres 0-100 Feet.
Dive types
dayboatwallnightdrift

Marine Life
bigsmallsharksdolphinsturtlescoral

Diving facilities
airnitroxrepairshireinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyphireinstruction

by Svetoslav Dimitrov
This single fish was taken with Sony Ciber Shot, internal light.

by Cipriano (ripli) Gonzalez
Manta magic atmosphere

by Marchione Giacomo
The Devil Nikon 800E , 17/35mm ,2.8 No strobo
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication