Latest Contest entries
Eyes of the Ocean  Seeds of Life   A blenny resting in a mussel shell  while tiny eggs gently decorate its surface.
By Gozde Karayel
posted 13:08 CST Today (within the last hour)
Serpula vermicularis_August 2025
 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted 08:17 CST Today (5 hours ago)
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted (4 days ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (6 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (6 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (last week)

Underwater Photo Location: Tug 2, Exiles

Underwater Photo Location: Tug 2, Exiles

How Hot is this Dive Site? click a star to rate it
A real nice "Donald Duck" wreck, sunk in 2013 in Sliema as artificial reef. Really good for the first penetration steps. Maximum depth 21.1 meters. Summer temperature 27 degrees. Winter temperature 15 degrees. Visibilty 10- 40 meters. Angry fish: none. Friendly fish: a lot. A very nice wreck dive for beginners and of course if you haven't seen it for advanced divers as well! Welcome to Malta!
Facts about Tug 2, Exiles
  • It is in Malta
  • Tug 2, Exiles is in the Mediterranean Sea.
  • The typical depth is 0-30 Metres 0-100 Feet.
  • The typical visibility is 10-30 Metres 30-100 Feet.
Dive types
dayboatshorewreck

Marine Life
small

Diving facilities
airnitroxrepairshireinstructionguidedfriendly

Photo facilities
wideanglefilmpfriendlyphireinstruction

by Patrik Engstrom
Diving the Tug 2 with Patrik Engstrom in Malta, Sliema - the best experience ever, no other divers around!

by Victor Micallef
Baby squid

by Victor Micallef
Giant tun

by Christian Llewellyn
The engine room of the Wreck - Tug 2

by Christian Llewellyn
Tug 2 - Wreck. Silema - Malta

by David Agius
Nudibranch on reef next to Tug2 Wreck at Exiles Beach, Sliema
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication