Latest Contest entries
Eyes of the Ocean  Seeds of Life   A blenny resting in a mussel shell  while tiny eggs gently decorate its surface.
By Gozde Karayel
posted Friday, August 22, 2025
Serpula vermicularis_August 2025
 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted Yesterday
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted (5 days ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (last week)
A conch just exploring the substrate
By Arun Madisetti
posted (last week)
Passage in Ressel   France
By Andy Kutsch
posted (last week)

Underwater Photo Location: The jetty of Sam's Tour Diving

Underwater Photo Location: The jetty of Sam's Tour Diving

How Hot is this Dive Site? click a star to rate it
Good
Facts about The jetty of Sam's Tour Diving
  • It is in Palau
  • The jetty of Sam's Tour Diving is in the Pacific.
  • The typical depth is 0-10 Metres 0-30 Feet.
  • The typical visibility is 0-3 Metres 0-10 Feet.
Dive types
dayboatwreckcavewallnight

Marine Life
bigsmallsharkswhalesdolphinsturtlescoral

Diving facilities
airnitroxrepairsguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyrepairsinstruction

by Alberto D'este
the lips of mandarin fish
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication