Latest Contest entries
Eyes of the Ocean  Seeds of Life   A blenny resting in a mussel shell  while tiny eggs gently decorate its surface.
By Gozde Karayel
posted 13:08 CST Today (within the last hour)
Serpula vermicularis_August 2025
 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted 08:17 CST Today (5 hours ago)
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted (4 days ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (6 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (6 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (last week)

Underwater Photo Location: Lac des Îles à Sion

Underwater Photo Location: Lac des Îles à Sion

How Hot is this Dive Site? click a star to rate it
Beautiful artificial lac in the capital city of the Valais... Sion.
Facts about Lac des Îles à Sion
  • It is in Switzerland
  • The typical depth is 0-40 Metres 0-130 Feet.
  • The typical visibility is 3-10 Metres 10-30 Feet.
Dive types
shorewallnightdrysuitfreshwaterice

Marine Life
small

Diving facilities
airnitroxrepairshireinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyphireinstruction

by Michel Lonfat
My friend JP and his UnderWater Video Material. Autumn has arrived - and it's beautifull colors - but also the first snow in our mountains. As we say : "the colder it is - the better the visibility is"... :O) ...

by Michel Lonfat
The eye of a young Crayfish... :O) ...

by Michel Lonfat
Technical Trainning dive... in the fresh waters of our lakes... :O)...

by Michel Lonfat
Super Macro of the Eye of a Pike Fish - done with a 105mm with a WetDiopter No2 ... :O) ...

by Michel Lonfat
The Eye of a Fresh Water Eel... :O)...

by Michel Lonfat
End of the day diving - today - just before night fall.... Having fun "under the ice"... Just beautiful... :O)...

by Michel Lonfat
Diving under the ice... Just 5° -> That's one for Jeff ... :O) ...

by Michel Lonfat
"Yes my dear : this is puuuuure ice" - Diving under the Ice with Faby in Valais Switzerland just before night fall. Pure Cristal Water (5° Jeff !) - and the ice very thick and very pure (transparent - no snow on it) - QUE du BONHEUR ...:O)...

by Michel Lonfat
Yesterday's under The Ice Diving. With my friend JP : these days the ice is still thick but easly breakable - you can come out where ever you want. So no need of safety lines. Just perfect to dive. ...:O)... But quite fresh...

by Michel Lonfat
End of today's dive... Water, Ice and a Tree... The water is just fantastic.

by Michel Lonfat
Just came back from a dive week-end under the ice with my wife. Waow just discovered a beautiful surprise. Thank-you so much for this title. I am really touched. Michel ...:O) ...

by Michel Lonfat
"Touching the ice" - Night fall dive under the Ice. Faby is playing with the air bubbles stuck under the roof ice... Que du bonheur... :O)...

by Michel Lonfat
Beautiful dive with my friends Dan and Sven today (here Sven at the end of the dive)... Almost no more ice, but very good visibillity - outside temp (this is for Jeff) - 5°. Que du bonheur ...:O)...

by Michel Lonfat
After the picture of Sven, here is one of Dan... in action... in a Valais lake just before the Fendant... :O)...

by Daniel Strub
After having seen pictures of Sven and me made by Michel, i bring you the MAKING OF: it's Michel getting a snapshot of Sven finishing his dive :-) To take Michels favourite expression: que du BONHEUR ;-)

by Michel Lonfat
My wife Caroline (on the right) with Sophie under the ice... Que du Bonheur... :O)...

by Daniel Strub
Trying to discover Mitch's secret of Worldclass photos :-)) hihihiii ... Great fun diving with Sven and Michel.

by Michel Lonfat
Branches of a tree caught in the waters of our lake. Beautiful and magical scenery. Today's after work dive. "Que du Bonheur..." ...:O)...

by Michel Lonfat
A grub of an insecte - an Odonate - 4 meters deep. No croping et que du Bonheur... :O)... 105mm with Wetdiopter Seacam No2.

by Michel Lonfat
Yesterday's dive with my wife Caroline in the clear waters of our small lake... Que du Bonheur... :O)...

by Michel Lonfat
Freshwater Atmospher.... Que du Bonheur... :O) - this week-end dive in our Clear Water of our small lake...

by Michel Lonfat
My friend JP in the Cristal Clear waters of our small lake - not far from home... Que du bonheur... :O)...

by Michel Lonfat
Under the Ice - Diving.... Que du bonheur... :O)...

by Michel Lonfat
A beautiful Noble crayfish in a little lake not far from home... Que du bonheur... :O)....

by Michel Lonfat
My Freind Sven diving in a small lake not far from home last winter - half of the lake was under the ice... Que du bonheur... :O)...

by Michel Lonfat
Today's dive - under the Ice... The viz was just amazing. My friend Vincent playing with the air blocked under the ice. Que du bonheur... :O)...

by Michel Lonfat
In winter, as the water is colder, the viz in our lakes is just fantastic... Photo taken yesterday in a small lake not far from home... Que du bonheur...

by Michel Lonfat
My friend JP - in the clear waters of the lake Des Îles - not far from home. End of the today's dive.... Que du bonheur... :O)...

by Michel Lonfat
Diving one of our Freshwater lakes not far from home with my friend Stéphane. The viz is getting worse in just one week. But still Que du bonheur... :O)....

by Michel Lonfat
The clear waters of our small lakes. Que du bonheur... :O)...

by Michel Lonfat
A close shot of a Perch during my last night dive... Que du Bonheur... :O)...

by Michel Lonfat
King Pike Fish Hunting Time... Close to the surface... Small lake not far from home... Que du bonheur... :O)...

by Michel Lonfat
My good friend JP diving in the cristal clear waters of a small lake not far from home... Que du bonheur... :O)...

by Michel Lonfat
A Curious Perch looking into my Dom - probably at her reflexion - during my safety stop... Natural light... Que du bonheur... :O)...

by Michel Lonfat
My good friend JP diving in the clear waters of our small lake not far from home... Like I always say : c'est que du bonheur... :O)...

by Raoul Caprez
Bad visibility today :-( ... follow the branches to come out !

by Raoul Caprez
A window through the ice. Thanks Michel and Bernard for this nice dive :-)

by Michel Lonfat
Bernard under the Ice... Que du bonheur... :O)...

by Raoul Caprez
Natural "ice filter" ... juste a small hole in the ice to see better the top of the tree ...
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication