Latest Contest entries
Eyes of the Ocean  Seeds of Life   A blenny resting in a mussel shell  while tiny eggs gently decorate its surface.
By Gozde Karayel
posted 13:08 CST Today (within the last hour)
Serpula vermicularis_August 2025
 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted 08:17 CST Today (5 hours ago)
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted (4 days ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (6 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (6 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (last week)

Underwater Photo Location: Etang de Mouchys

Underwater Photo Location: Etang de Mouchys

How Hot is this Dive Site? click a star to rate it
Beautiful small medium altitude lake in the region of Savièse in Valais. This lake is not often divable. Most of the time in Winter. But in March very interesting for water frogs or ice diving. Not very deep.
Facts about Etang de Mouchys
  • It is in Switzerland
  • The typical depth is 0-10 Metres 0-30 Feet.
  • The typical visibility is 0-3 Metres 0-10 Feet.
Dive types
shoredrysuitfreshwaterice

Marine Life
small

Diving facilities
airnitroxrepairshireinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyrepairsphireinstruction

by Michel Lonfat
Picture taken this week-end of the small medium altitude lakes we dive in my region. Just to show the beautiful Autumn colors we have actually... :O) ...
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication