Latest Contest entries
Eyes of the Ocean  Seeds of Life   A blenny resting in a mussel shell  while tiny eggs gently decorate its surface.
By Gozde Karayel
posted 13:08 CST Today (within the last hour)
Serpula vermicularis_August 2025
 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted 08:17 CST Today (5 hours ago)
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted (4 days ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (6 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (6 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (last week)

Underwater Photo Location: Diver's Dream

Underwater Photo Location: Diver's Dream

How Hot is this Dive Site? click a star to rate it
We were diving for two weeks every single day, did dives on both ends of the island, but, couldn't get enough of Diver's Dream, we dove with Manta Dive on Pigeon Point Road, and they were just fantastic!! Very friendly and well organized... I prefer diving on the southern end, off Crown Point, however.
Facts about Diver's Dream
  • It is in Trinidad and Tobago
  • The typical depth is 0-30 Metres 0-100 Feet.
  • The typical visibility is 10-30 Metres 30-100 Feet.
Dive types
dayboatshorewreckwallnightdrift

Marine Life
bigsmallsharksturtlescoral

Diving facilities
airrepairshireinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyphireinstruction
underwater photos Trinidad and Tobago
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication