Latest Contest entries
Eyes of the Ocean  Seeds of Life   A blenny resting in a mussel shell  while tiny eggs gently decorate its surface.
By Gozde Karayel
posted 13:08 CST Today (within the last hour)
Serpula vermicularis_August 2025
 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted 08:17 CST Today (5 hours ago)
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted (4 days ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (6 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (6 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (last week)

Underwater Photo Location: Ras Bob Reef, Sharm el Sheikh, Red Sea, Egypt

Underwater Photo Location: Ras Bob Reef, Sharm el Sheikh, Red Sea, Egypt

How Hot is this Dive Site? click a star to rate it
I think the overhead shot of this Lion fish make the patterns on its fins look more striking
Facts about Ras Bob Reef, Sharm el Sheikh, Red Sea, Egypt
  • It is in Egypt
  • Ras Bob Reef, Sharm el Sheikh, Red Sea, Egypt is in the Red Sea.
  • The typical depth is 0-10 Metres 0-30 Feet.
  • The typical visibility is 30+ Metres 100+ Feet.
Dive types
shore

Marine Life
coral

Diving facilities
airnitroxrepairshireinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyphireinstruction

by Stephen Carr
i took this photo of a Lion fish on Ras Bob Reef,
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication