Latest Contest entries
Eyes of the Ocean  Seeds of Life   A blenny resting in a mussel shell  while tiny eggs gently decorate its surface.
By Gozde Karayel
posted 13:08 CST Today (within the last hour)
Serpula vermicularis_August 2025
 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted 08:17 CST Today (5 hours ago)
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted (4 days ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (6 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (6 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (last week)

Underwater Photo Location: Just of the coast of Nassau

Underwater Photo Location: Just of the coast of Nassau

How Hot is this Dive Site? click a star to rate it
Alone
This was a wreck that had been sunk when it was no longer useful. Sometimes we look at wrecks or their remains and it reminds us what it is like to grow old and alone.
Facts about Just of the coast of Nassau
  • It is in Canada
  • Just of the coast of Nassau is in the Caribbean Sea.
  • The typical depth is 0-20 Metres 0-60 Feet.
  • The typical visibility is 0-3 Metres 0-10 Feet.
Dive types
dayboatwreck

Marine Life
smallsharksturtlescoralstinging

Diving facilities
airnitroxguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyphireinstruction

by Murray Scott
Alone This was taken just off the coast of Nassau at about 45 ft. with a Nik V. and a 20mm. Lens and a Nikonos SB105 strobe. This was my first attempt at shooting underwater. With respect to this wreck it is interesting to see what time has done.
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication