Latest Contest entries
Eyes of the Ocean  Seeds of Life   A blenny resting in a mussel shell  while tiny eggs gently decorate its surface.
By Gozde Karayel
posted 13:08 CST Today (within the last hour)
Serpula vermicularis_August 2025
 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted 08:17 CST Today (5 hours ago)
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted (4 days ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (6 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (6 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (last week)

Underwater Photo Location: Abyss Kythnos

Underwater Photo Location: Abyss Kythnos

How Hot is this Dive Site? click a star to rate it
It is a fantastic dive site. Some they call it Abyss (dive site name), some they call it the Narkosis Theater and some they call it Horse Head. Only one thing I can tell It is really amazing. Only when you dive there you can understand what I mean.
Facts about Abyss Kythnos
  • It is in Greece
  • The typical depth is 0-50 Metres 0-160 Feet.
  • The typical visibility is 30+ Metres 100+ Feet.
Dive types
dayboatshorewall

Marine Life
bigsmallcoral

Diving facilities
airnitroxrepairsinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyphireinstruction
underwater photos Greece
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication