Latest Contest entries
Eyes of the Ocean  Seeds of Life   A blenny resting in a mussel shell  while tiny eggs gently decorate its surface.
By Gozde Karayel
posted 13:08 CST Today (within the last hour)
Serpula vermicularis_August 2025
 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted 08:17 CST Today (5 hours ago)
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted (4 days ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (6 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (6 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (last week)

Underwater Photo Location: Randy's Gazebo, in Little Cayman

Underwater Photo Location: Randy's Gazebo, in Little Cayman

How Hot is this Dive Site? click a star to rate it
Bloody Bay Marine Park, Little Cayman, Northside
Always fabulous. On this day, 7/28/2009, Calm seas. 150 feet vis, 84 degrees, slight current.
Facts about Randy's Gazebo, in Little Cayman
  • It is in Cayman islands
  • Randy's Gazebo, in Little Cayman is in the Caribbean Sea.
  • The typical depth is 0-30 Metres 0-100 Feet.
  • The typical visibility is 30+ Metres 100+ Feet.
Dive types
wall

Marine Life
bigsmallturtles

Diving facilities
airnitroxrepairshireinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyphireinstruction

by Larissa Roorda
A yellow sponge at Randy's Gazebo, Bloody Bay Marine Park, Little Cayman. Taken with D300, 15mm.

by John Loving
Taken on the north side of Little cayman
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication