Latest Contest entries
Eyes of the Ocean  Seeds of Life   A blenny resting in a mussel shell  while tiny eggs gently decorate its surface.
By Gozde Karayel
posted 13:08 CST Today (within the last hour)
Serpula vermicularis_August 2025
 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted 08:17 CST Today (5 hours ago)
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted (4 days ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (6 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (6 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (last week)

Underwater Photo Location: Fahal island

Underwater Photo Location: Fahal island

How Hot is this Dive Site? click a star to rate it
Fahal Islands in Muscat is a centre of coral diversity

Exposed rocky shores facing north and east is the hub of soft coral growth, while south and west facing shores contain hard coral growth, for example at Cat Island, Cemetery Bay and Fahal Island.

The Damaniyat Islands, about 17-km offshore, support extensive reef development. Damaniyat reefs are typically dominated by a few genera, but at some sites where the assemblage is mixed, coral diversity is known to be high. Damaniyat reefs provide a diverse habitat and feeding grounds for commercially important fish and a high potential value to Oman’s tourist industry, says Mussallam, who being an active diver has watched coral reefs from close quarters.

Sharqiya coast, which used to be an area of luxuriant coral growth, has only a few reef formations now. Much of the previously luxuriant coral growth was destroyed in a storm a few years ago.

Facts about Fahal island
  • It is in Oman
  • Fahal island is in the Arabian Sea.
  • The typical depth is 0-40 Metres 0-130 Feet.
  • The typical visibility is 10-30 Metres 30-100 Feet.
Dive types
dayboatshorecavewall

Marine Life
bigsharkswhalesdolphinsturtlescoralshoals

Diving facilities
airnitroxrepairshireinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyrepairsphireinstruction

by Mike Dickson
6mm nudibranch spotted in North Bay, Fahal Island. Photo taken in manual mode with my DX1G.

by Patrik Engstrom
Diver and puffer fish
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication