Latest Contest entries
Eyes of the Ocean  Seeds of Life   A blenny resting in a mussel shell  while tiny eggs gently decorate its surface.
By Gozde Karayel
posted 13:08 CST Today (within the last hour)
Serpula vermicularis_August 2025
 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted 08:17 CST Today (5 hours ago)
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted (4 days ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (6 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (6 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (last week)

Underwater Photo Location: Back of the reef

Underwater Photo Location: Back of the reef

How Hot is this Dive Site? click a star to rate it
Take a kayak off the back of the reef and get lucky with some of the most amazing creatures in the ocean, drift along and see whalesharks, mantas and whales....
Facts about Back of the reef
  • It is in Australia
  • Back of the reef is in the Indian Ocean.
  • The typical depth is 0-30 Metres 0-100 Feet.
  • The typical visibility is 10-30 Metres 30-100 Feet.
Dive types
dayboatshoredrift

Marine Life
bigsmallsharkswhalesdolphinsturtlescoralshoalsstinging

Diving facilities
airnitroxrepairshireinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyrepairsphireinstruction

by Nick Thake
A large whaleshark swimming off ningaloo

by Graeme Cole
Yellow back threefin taken 100mm macro on its first dive.

by Graeme Cole
Hey pic me :)

by Liam Triggs-Fulton
Two Nudibranch's mating, Found these two at the end of the dive about to go up the anchor line.
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication