Latest Contest entries
Eyes of the Ocean  Seeds of Life   A blenny resting in a mussel shell  while tiny eggs gently decorate its surface.
By Gozde Karayel
posted 13:08 CST Today (within the last hour)
Serpula vermicularis_August 2025
 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted 08:17 CST Today (5 hours ago)
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted (4 days ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (6 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (6 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (last week)

Underwater Photo Location: Madivaru Thila, South Ari Atoll, Maldives

Underwater Photo Location: Madivaru Thila, South Ari Atoll, Maldives

How Hot is this Dive Site? click a star to rate it
A nice Thila that you can easily dive around during one dive (50 minutes limit). You find walls, overhang, soft and hard corals. On one side of the thila, depending on day time, you will encounter a low current, but usually not that strong.
Facts about Madivaru Thila, South Ari Atoll, Maldives
  • It is in Maldives
  • Madivaru Thila, South Ari Atoll, Maldives is in the Indian Ocean.
  • The typical depth is 0-30 Metres 0-100 Feet.
  • The typical visibility is 10-30 Metres 30-100 Feet.
Dive types
dayboatwalldrift

Marine Life
smallturtlescoral

Diving facilities
airnitroxinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyphireinstruction

by Olivier Notz
Bruun’s cleaning partner shrimp This shrimp was swimming in front of a moray.
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication