Latest Contest entries
Eyes of the Ocean  Seeds of Life   A blenny resting in a mussel shell  while tiny eggs gently decorate its surface.
By Gozde Karayel
posted 13:08 CST Today (within the last hour)
Serpula vermicularis_August 2025
 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted 08:17 CST Today (5 hours ago)
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted (4 days ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (6 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (6 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (last week)

Underwater Photo Location: Alad Sanctuary Garden, Alad Island, Romblon

Underwater Photo Location: Alad Sanctuary Garden, Alad Island, Romblon

How Hot is this Dive Site? click a star to rate it
The fish sanctuary of Alad is well known for its endless soft coral fields, barrel sponges and abundant marine life. A true diver’s paradise! Start your dive in shallow waters and gradually slope to a maximum depth of 35 meters. This underwater landscape is teeming with marine life and enveloped in dense coral formations. Ideal for macro photography. This site also provides great snorkeling opportunity.

This spot can be reached in 20 to 30 minutes from Romblon Town or Lonos, Romblon. This spot can be visit 12 months a year.


Facts about Alad Sanctuary Garden, Alad Island, Romblon
  • It is in Philippines
  • The typical depth is 0-40 Metres 0-130 Feet.
  • The typical visibility is 10-30 Metres 30-100 Feet.
Dive types
dayboatshorewallnight

Marine Life
bigsmallturtlescoralshoals

Diving facilities
airnitroxrepairshireinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyrepairsphireinstruction
underwater photos Philippines
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication