Latest Contest entries
Eyes of the Ocean  Seeds of Life   A blenny resting in a mussel shell  while tiny eggs gently decorate its surface.
By Gozde Karayel
posted 13:08 CST Today (within the last hour)
Serpula vermicularis_August 2025
 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted 08:17 CST Today (5 hours ago)
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted (4 days ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (6 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (6 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (last week)

Underwater Photo Location: Bangug Island, Romblon, Romblon

Underwater Photo Location: Bangug Island, Romblon, Romblon

How Hot is this Dive Site? click a star to rate it
Bangug Island is a small reef system running parallel to the island and ending in a maximum depth of 20 meters. Start your dive in a depth of 2 meters and gradually make your way to the sandy bottom. In the sea grass fields and under the blocks there is a lot to discover. Suitable for all level divers.

This spot can be reached in 15 to 20 minutes from Romblon Town or Lonos, Romblon. This spot can be visit 12 months a year.


Facts about Bangug Island, Romblon, Romblon
  • It is in Philippines
  • The typical depth is 0-30 Metres 0-100 Feet.
  • The typical visibility is 10-30 Metres 30-100 Feet.
Dive types
dayboatnight

Marine Life
bigsmallturtlescoral

Diving facilities
airnitroxrepairshireinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyphireinstruction

by Hakan Basar
Chirostylus Sandyi, Spider Squat Lobster

by Hakan Basar
Cyerce Sp. Butterfly Nudibranch
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication