Latest Contest entries
Eyes of the Ocean  Seeds of Life   A blenny resting in a mussel shell  while tiny eggs gently decorate its surface.
By Gozde Karayel
posted 13:08 CST Today (within the last hour)
Serpula vermicularis_August 2025
 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted 08:17 CST Today (5 hours ago)
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted (4 days ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (6 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (6 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (last week)

Underwater Photo Location: Logbon Coral Canyon, Logbon Island, Romblon, Romblon

Underwater Photo Location: Logbon Coral Canyon, Logbon Island, Romblon, Romblon

How Hot is this Dive Site? click a star to rate it
An outstanding display of corals and marine life whilst you are diving through valleys and above colorful slopes. Very topographical and scenic dive with good photo and snorkeling opportunities.
Facts about Logbon Coral Canyon, Logbon Island, Romblon, Romblon
  • It is in Philippines
  • The typical depth is 0-40 Metres 0-130 Feet.
  • The typical visibility is 10-30 Metres 30-100 Feet.
Dive types
dayboatshorewallnight

Marine Life
bigsmallcoralshoals

Diving facilities
airnitroxrepairshireinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyphireinstruction

by Chan Kwon
A couple

by Chan Kwon
Biiiiiiiiiiig eye
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication