Latest Contest entries
Eyes of the Ocean  Seeds of Life   A blenny resting in a mussel shell  while tiny eggs gently decorate its surface.
By Gozde Karayel
posted 13:08 CST Today (within the last hour)
Serpula vermicularis_August 2025
 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted 08:17 CST Today (5 hours ago)
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted (4 days ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (6 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (6 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (last week)

Underwater Photo Location: Origon Rocks, Tablas Island, Romblon

Underwater Photo Location: Origon Rocks, Tablas Island, Romblon

How Hot is this Dive Site? click a star to rate it
A true diver’s paradise!
Situated in a depth of 10 to 25 meters and surrounded by clean sand, you will find a spectacular reef covered in table, tube and soft corals, teeming with marine life. Outstanding bottom topography makes for great photo opportunity.

Facts about Origon Rocks, Tablas Island, Romblon
  • It is in Philippines
  • The typical depth is 0-30 Metres 0-100 Feet.
  • The typical visibility is 10-30 Metres 30-100 Feet.
Dive types
dayboat

Marine Life
bigsmallcoralshoals

Diving facilities
airnitroxrepairshireinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyphireinstruction
underwater photos Philippines
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication