Latest Contest entries
Eyes of the Ocean  Seeds of Life   A blenny resting in a mussel shell  while tiny eggs gently decorate its surface.
By Gozde Karayel
posted 13:08 CST Today (within the last hour)
Serpula vermicularis_August 2025
 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted 08:17 CST Today (5 hours ago)
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted (4 days ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (6 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (6 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (last week)

Underwater Photo Location: San Pedro Sanctuary, Romblon Island, Romblon

Underwater Photo Location: San Pedro Sanctuary, Romblon Island, Romblon

How Hot is this Dive Site? click a star to rate it
Well known and famous for the large amounts of inhabiting turtles to be seen here. This also happens to be the biggest attraction to this site. The reef here boasts some of the best coral formations and marine life to be seen in Romblon Island. Suitable for all level divers.

This spot can be reached in 10 minutes from Lonos, Romblon or 20 minutes from Romblon Town. This spot can be visit 12 months a year.
Facts about San Pedro Sanctuary, Romblon Island, Romblon
  • It is in Philippines
  • The typical depth is 0-40 Metres 0-130 Feet.
  • The typical visibility is 10-30 Metres 30-100 Feet.
Dive types
dayboatshorenight

Marine Life
bigsmallturtlescoralshoals

Diving facilities
airnitroxrepairshireinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyphireinstruction
underwater photos Philippines
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication