Latest Contest entries
Eyes of the Ocean  Seeds of Life   A blenny resting in a mussel shell  while tiny eggs gently decorate its surface.
By Gozde Karayel
posted 13:08 CST Today (within the last hour)
Serpula vermicularis_August 2025
 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted 08:17 CST Today (5 hours ago)
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted (4 days ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (6 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (6 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (last week)

Underwater Photo Location: Sasaigang Point, Logbon Island, Romblon, Romblon

Underwater Photo Location: Sasaigang Point, Logbon Island, Romblon, Romblon

How Hot is this Dive Site? click a star to rate it
Situated on the tip of Logbon Island a small rocky island just off the coast of Romblon. This dive starts in a depth of 3 meters and gently drops to a depth of 15 meters where you will find some of the most prolific corals. Ideal for photography and beginner divers to explore.

This spot can be reached in 20 to 30 minutes from Romblon Town or Lonos, Romblon. This spot can be visit 12 months a year.
Facts about Sasaigang Point, Logbon Island, Romblon, Romblon
  • It is in Philippines
  • The typical depth is 0-20 Metres 0-60 Feet.
  • The typical visibility is 10-30 Metres 30-100 Feet.
Dive types
dayboatshorenight

Marine Life
bigsmallsharksturtlescoralshoals

Diving facilities
airnitroxrepairshireinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyphireinstruction
underwater photos Philippines
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication