Latest Contest entries
Eyes of the Ocean  Seeds of Life   A blenny resting in a mussel shell  while tiny eggs gently decorate its surface.
By Gozde Karayel
posted 13:08 CST Today (within the last hour)
Serpula vermicularis_August 2025
 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted 08:17 CST Today (5 hours ago)
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted (4 days ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (6 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (6 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (last week)

Underwater Photo Location: Sunken Island (CSI), Cobrador Island, Romblon, Romblon

Underwater Photo Location: Sunken Island (CSI), Cobrador Island, Romblon, Romblon

How Hot is this Dive Site? click a star to rate it
As the name tells this is basically a beautiful submerged island covered in corals. Starting at 10 meters sloping down to 30 meters. Whilst diving around the island you can find many different fish species, nudibranchs and cuttlefish. This site also provides great photo opportunity.

This spot can be reached in 30 to 40 minutes from Romblon Town or Lonos, Romblon. This spot can be visit 12 months a year.


Facts about Sunken Island (CSI), Cobrador Island, Romblon, Romblon
  • It is in Philippines
  • The typical depth is 0-40 Metres 0-130 Feet.
  • The typical visibility is 10-30 Metres 30-100 Feet.
Dive types
dayboat

Marine Life
bigsmallturtlescoralshoals

Diving facilities
airnitroxrepairshireinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyphireinstruction
underwater photos Philippines
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication