Latest Contest entries
Eyes of the Ocean  Seeds of Life   A blenny resting in a mussel shell  while tiny eggs gently decorate its surface.
By Gozde Karayel
posted Friday, August 22, 2025
Serpula vermicularis_August 2025
 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted Yesterday
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted (5 days ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (last week)
A conch just exploring the substrate
By Arun Madisetti
posted (last week)
Passage in Ressel   France
By Andy Kutsch
posted (last week)

Underwater Photo Location: Big Tunnels

Underwater Photo Location: Big Tunnels

How Hot is this Dive Site? click a star to rate it
This is a great site for large coral formations, swim throughs and small dead end caverns. During the late summer huge schools of silversides attract large marine life such as grouper, tarpon, and jack. Average depth is approx 100-110 feet at the most attractive areas of the reef with visability in excess of 100ft.
Facts about Big Tunnels
  • It is in Cayman islands
  • Big Tunnels is in the Caribbean Sea.
  • The typical depth is 0-40 Metres 0-130 Feet.
  • The typical visibility is 30+ Metres 100+ Feet.
Dive types
dayboatwall

Marine Life
bigsmallcoral

Diving facilities
airnitroxinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyrepairsinstruction

by Steven Gollehon
Large school of silversides at Big Tunnels in Grand Cayman. Taken with Nikon d300s using Tokina 10-17 wide angle fisheye lens.

by Chase Darnell
"Face Paint" A detailed and colorful Blenny portrait.

by Chase Darnell
"Fish Life" There is a certain ridge on the dive site Big Tunnels that boasts some of the best juvenile fish life on the island.

by Chase Darnell
"Flowers" Coral polyps with a nice orange background.

by Chase Darnell
"The Queen" The colors of the Queen Angel Fish are so vibrant. It isn't very often they will allow you to get close enough for a face on portrait. I think the Turtle eating right beside this one gave it a reason to stick around.

by Chase Darnell
"Curious" These aren't always the most cooperative subjects. After taking a couple of shots with just the 100mm, I decided to try the +10 Diopter. Luckily this guys was holding his ground and let me get extremely close.

by Chase Darnell
"My Reef" A Hawksbill Turtle settling down to feed with a diver approaching in the background.

by Chase Darnell
"Golden File" A Juvenile Slender File Fish hanging out around a red rope sponge.

by Chase Darnell
"Documentation" It's nice to interact with other photographers underwater. Creating nice "behind the scenes" type photos. Behind every image their is a photographer.
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication