Latest Contest entries
Eyes of the Ocean Seeds of Life A blenny resting in a mussel shell while tiny eggs gently decorate its surface.
By Gozde Karayel
posted 13:08 CST Today (within the last hour)
Serpula vermicularis_August 2025 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted 08:17 CST Today (5 hours ago)
Lamprohaminoea ovalis_August 2025 CanonRF100 1/200 f16 iso100
By Antonio Venturelli
posted (4 days ago)
Hypselodoris krakatoa nudibranch_March 2025 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (6 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (6 days ago)
Passage in Ressel France
By Andy Kutsch
posted (last week)

Underwater Photo Location: Padang Bay

Underwater Photo Location: Padang Bay

How Hot is this Dive Site? click a star to rate it
Real macro world
Facts about Padang Bay
  • It is in Indonesia
  • Padang Bay is in the Bali Sea.
  • The typical depth is 0-50 Metres 0-160 Feet.
Dive types
Liveaboarddayboatshorewallnight

Marine Life
bigsmallcoral

Diving facilities
airhireinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyphireinstruction

by Sinan Kamiloglu
How stupid it looks..!

by Anouk Houben
Squid with its catch.

by Anouk Houben
Red on red

by Anouk Houben
Shrimp on an anemone.

by Irwin Ang
F L O W - I N G False cleanerfish (Aspidontus taeniatus) Padangbai (Bali), Indonesia. July 2015

by Sofia Tenggrono
Janolus sp.

by Sofia Tenggrono
Coryphellina exoptata

by Janet Hale
Saw this Goniobranchus while diving in Pandang Bay, Bali.
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication