Latest Contest entries
Eyes of the Ocean  Seeds of Life   A blenny resting in a mussel shell  while tiny eggs gently decorate its surface.
By Gozde Karayel
posted 13:08 CST Today (within the last hour)
Serpula vermicularis_August 2025
 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted 08:17 CST Today (5 hours ago)
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted (4 days ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (6 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (6 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (last week)

Underwater Photo Location: Ras Sannut - Wonderwall

Underwater Photo Location: Ras Sannut - Wonderwall

How Hot is this Dive Site? click a star to rate it
Wall / Drift Dive: Spotted Trigger Fish, Box Fish, Yellow-Fin Hind, Spotted Ray, Juvinile Angle Fish, Jacks, Travalley, Porcopine Fish, Puffer Fish, lots of coral
Facts about Ras Sannut - Wonderwall
  • It is in Oman
  • Ras Sannut - Wonderwall is in the Gulf Of Oman.
  • The typical depth is 0-20 Metres 0-60 Feet.
  • The typical visibility is 3-10 Metres 10-30 Feet.
Dive types
dayboatdrift

Marine Life
smallcoralshoalsstinging

Diving facilities
airnitroxhireinstructionfriendly

Photo facilities
macrowideanglefilmpfriendlyrepairsinstruction

by Wayne Taylor
Batfish + 2 admiring divers

by Ramy Omar
Taken By Sony DCS-W350 Cyber Shoot camera and Sony marine pack housing
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication