Latest Contest entries
Eyes of the Ocean  Seeds of Life   A blenny resting in a mussel shell  while tiny eggs gently decorate its surface.
By Gozde Karayel
posted 13:08 CST Today (within the last hour)
Serpula vermicularis_August 2025
 Canon RF100 1/200 f8 iso100
By Antonio Venturelli
posted 08:17 CST Today (5 hours ago)
Lamprohaminoea ovalis_August 2025
 CanonRF100  1/200 f16 iso100
By Antonio Venturelli
posted (4 days ago)
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (6 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (6 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (last week)

Underwater Photo Location: Lumba Lumba House Reef

Underwater Photo Location: Lumba Lumba House Reef

How Hot is this Dive Site? click a star to rate it
Fra broken coral forrest, turn left. For local wreck and sandy bottoms, turn right on the reef.
Facts about Lumba Lumba House Reef
  • It is in Indonesia
  • Lumba Lumba House Reef is in the Laccidive Sea.
  • The typical depth is 0-20 Metres 0-60 Feet.
  • The typical visibility is 10-30 Metres 30-100 Feet.
Dive types
shore

Marine Life
small

Diving facilities
airnitroxhireinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyphireinstruction

by Henrik Hedegaard
Eye of the Dwarf Lion Fish

by Henrik Hedegaard
The artificial wreck on the Lumba Lumba house reef is a unique habitat for all the small critters. Wood, tubes, stones - you name it and it's there. This blennie was hiding i a tiny tube, 15cm above a Giant Moray Eel.
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication