Latest Contest entries
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted 10:07 CST Today (within the last hour)
A conch just exploring the substrate
By Arun Madisetti
posted 03:40 CST Today (7 hours ago)
Passage in Ressel   France
By Andy Kutsch
posted (3 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (3 days ago)
Parablennius rouxi_August 2025
 CanonRF100 1/200 f9 iso100
By Antonio Venturelli
posted (6 days ago)
Diving the USS Kittiwake   A Submerged Treasure in Grand Cayman.
By Christian Llewellyn
posted (6 days ago)

Underwater Photo Location: las Galletas, chuchos

Underwater Photo Location: las Galletas, chuchos

How Hot is this Dive Site? click a star to rate it
At 2 minutes by boat from the harbor a wonderful site with huge rays, a bank of bastards grunts, trumpet fish, glass eyes, tiger and normal eals, a site full of life.
Facts about las Galletas, chuchos
  • It is in Spain
  • las Galletas, chuchos is in the Atlantic (European coastal).
  • The typical depth is 0-20 Metres 0-60 Feet.
  • The typical visibility is 3-10 Metres 10-30 Feet.
Dive types
dayboat

Marine Life
bigsmallturtles

Diving facilities
airhireinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyphireinstruction

by Erna Lucas
Agatha, our friendly turtle - Tenerife, Canary Islands panasonic dmc-ft1 lumix

by Rune Edvin Haldorsen
Moray eel
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication