Latest Contest entries
lamprohaminoea ovalis_August 2025 CanonRF100 1/200 f16 iso100
By Antonio Venturelli
posted 02:06 CST Today (14 hours ago)
Hypselodoris krakatoa nudibranch_March 2025 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted (2 days ago)
A conch just exploring the substrate
By Arun Madisetti
posted (2 days ago)
Passage in Ressel France
By Andy Kutsch
posted (5 days ago)
Passage in Ressel France
By Andy Kutsch
posted (5 days ago)
Parablennius rouxi_August 2025 CanonRF100 1/200 f9 iso100
By Antonio Venturelli
posted (last week)

Underwater Photo Location: Bodu Giri, Kuredu Island

Underwater Photo Location: Bodu Giri, Kuredu Island

How Hot is this Dive Site? click a star to rate it
perfect place for pros and begginers
Facts about Bodu Giri, Kuredu Island
  • It is in Maldives
  • Bodu Giri, Kuredu Island is in the Indian Ocean.
  • The typical depth is 0-30 Metres 0-100 Feet.
Dive types
dayboatwallnightdrift

Marine Life
bigsmallsharksdolphinsturtlescoral

Diving facilities
airnitroxrepairshireinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyphireinstruction

by Svetoslav Dimitrov
This single fish was taken with Sony Ciber Shot, internal light.

by Cipriano (ripli) Gonzalez
Manta magic atmosphere

by Marchione Giacomo
The Devil Nikon 800E , 17/35mm ,2.8 No strobo
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication