Latest Contest entries
Hypselodoris krakatoa nudibranch_March 2025
 CanonRF100 1/200 f18 iso100
By Antonio Venturelli
posted 10:07 CST Today (within the last hour)
A conch just exploring the substrate
By Arun Madisetti
posted 03:40 CST Today (7 hours ago)
Passage in Ressel   France
By Andy Kutsch
posted (3 days ago)
Passage in Ressel   France
By Andy Kutsch
posted (3 days ago)
Parablennius rouxi_August 2025
 CanonRF100 1/200 f9 iso100
By Antonio Venturelli
posted (6 days ago)
Diving the USS Kittiwake   A Submerged Treasure in Grand Cayman.
By Christian Llewellyn
posted (6 days ago)

Underwater Photo Location: Val Maggia Gola del Lupo

Underwater Photo Location: Val Maggia Gola del Lupo

How Hot is this Dive Site? click a star to rate it
Probably one of the best diving sites in Switzerland.
Facts about Val Maggia Gola del Lupo
  • It is in Switzerland
  • The typical depth is 0-10 Metres 0-30 Feet.
  • The typical visibility is 30+ Metres 100+ Feet.
Dive types
drysuitfreshwater

Marine Life
small

Diving facilities
airnitroxrepairshireinstructionguidedfriendly

Photo facilities
macrowideanglefilmpfriendlyrepairsphireinstruction

by Michel Lonfat
River diving this week-end. The weather was perfect - but the water was not as clear as usual... Val Maggia river in Tessin. The best Rive Dives in Switzerland... :O) ...

by Michel Lonfat
Diving the Val Maggia River ... :O) ...

by Michel Lonfat
My wife at the entrance of a Dive Site in the River Mal-Maggia... Que du Bonheur... :O)...

by Michel Lonfat
My wife Caroline - entering one of the pools - in the Val Maggia River... To get into this pool, you have to walk around 1/2 hour up the river. The walk is difficult (because rocky and slipery) but it is worth it. Que du Bonheur... :O)...

by Michel Lonfat
My Friend Titi Entering one of the Val Maggia Pool... As it is difficult to reach these Water Pools, we share the material. In the back-ground Caro my wife and Danielle waiting for their turn... Que du bonheur...:O)...

by Michel Lonfat
Scenary in the Verzasca Water... River diving... Que du bonheur... :O)...

by Michel Lonfat
Caroline Entering the Gola del Lupo - Val Maggia River... Que du bonheur... :O)

by Daniel Strub
Reflexions ... :-D

by Michael Baukloh
Gola del Lupo, River "Maggia"
add a dive siteShare your knowledge...

Add your favorite dive site to our database


Really Simple Syndication